LOCUS Exported 756 bp ds-DNA linear SYN 18-MAY-2021 DEFINITION Protein expression.. ACCESSION . VERSION . KEYWORDS pCri-4a SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 756) AUTHORS Goulas T, Cuppari A, Garcia-Castellanos R, Snipas S, Glockshuber R, Arolas JL, Gomis-Ruth FX TITLE The pCri System: A Vector Collection for Recombinant Protein Expression and Purification. JOURNAL PLoS One. 2014 Nov 11;9(11):e112643. doi: 10.1371/journal.pone.0112643. eCollection 2014. PUBMED 25386923 REFERENCE 2 (bases 1 to 756) AUTHORS . TITLE Direct Submission JOURNAL Exported May 18, 2021 from SnapGene Server 1.1.58 http://www.snapgene.com FEATURES Location/Qualifiers source 1..756 /organism="synthetic DNA construct" /mol_type="other DNA" primer_bind 156..175 /label=pBRrevBam /note="pBR322 vectors, tet region, downstream of BamHI, reverse primer" primer_bind 259..278 /label=T7 /note="T7 promoter, forward primer" promoter 259..277 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 278..302 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 317..339 /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 352..369 /codon_start=1 /product="6xHis affinity tag" /label=6xHis /translation="HHHHHH" CDS 373..699 /codon_start=1 /gene="trxA" /product="E. coli thioredoxin" /label=TrxA /translation="MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDE IADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFL DANLA" CDS 718..738 /codon_start=1 /product="tobacco etch virus (TEV) protease recognition and cleavage site" /label=TEV site /translation="ENLYFQG" ORIGIN 1 agtagtaggt tgaggccgtt gagcaccgcc gccgcaagga atggtgcatg caaggagatg 61 gcgcccaaca gtcccccggc cacggggcct gccaccatac ccacgccgaa acaagcgctc 121 atgagcccga agtggcgagc ccgatcttcc ccatcggtga tgtcggcgat ataggcgcca 181 gcaaccgcac ctgtggcgcc ggtgatgccg gccacgatgc gtccggcgta gaggatcgag 241 atctcgatcc cgcgaaatta atacgactca ctatagggga attgtgagcg gataacaatt 301 cccctctaga aataattttg tttaacttta agaaggagat ataccatgaa acatcaccat 361 caccatcacc ccatgagcga taaaattatt cacctgactg acgacagttt tgacacggat 421 gtactcaaag cggacggggc gatcctcgtc gatttctggg cagagtggtg cggtccgtgc 481 aaaatgatcg ccccgattct ggatgaaatc gctgacgaat atcagggcaa actgaccgtt 541 gcaaaactga acatcgatca aaaccctggc actgcgccga aatatggcat ccgtggtatc 601 ccgactctgc tgctgttcaa aaacggtgaa gtggcggcaa ccaaagtggg tgcactgtct 661 aaaggtcagt tgaaagagtt cctcgacgct aacctggccg gatctggcag tggttctgag 721 aatctttatt ttcagggcgc catggccaaa gtgagc //