LOCUS Exported 1026 bp ds-DNA linear SYN 19-MAY-2021 DEFINITION Doyon lab Tandem-Affinity Purification Following (i) Nuclease-Driven Gene Addition to the AAVS1 Genomic Safe Harbor Locus and (ii) Endogenous TAP Tagging.. ACCESSION . VERSION . KEYWORDS AAVS1_Puro_PGK1_3xFLAG_Twin_Strep SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 1026) AUTHORS Dalvai M, Loehr J, Jacquet K, Huard CC, Roques C, Herst P, Cote J, Doyon Y TITLE A Scalable Genome-Editing-Based Approach for Mapping Multiprotein Complexes in Human Cells. JOURNAL Cell Rep. 2015 Oct 7. pii: S2211-1247(15)01020-7. doi: 10.1016/j.celrep.2015.09.009. PUBMED 26456817 REFERENCE 2 (bases 1 to 1026) AUTHORS . TITLE Direct Submission JOURNAL Exported May 19, 2021 from SnapGene Server 1.1.58 http://www.snapgene.com FEATURES Location/Qualifiers source 1..1026 /organism="synthetic DNA construct" /mol_type="other DNA" promoter 91..601 /label=hPGK promoter /note="human phosphoglycerate kinase 1 promoter" primer_bind 520..538 /label=hPGK-F /note="Human PGK promoter, forward primer" CDS 630..650 /codon_start=1 /product="tobacco etch virus (TEV) protease recognition and cleavage site" /label=TEV site /translation="ENLYFQG" CDS 669..734 /codon_start=1 /product="three tandem FLAG(R) epitope tags, followed by an enterokinase cleavage site" /label=3xFLAG /translation="DYKDHDGDYKDHDIDYKDDDDK" CDS 744..833 /codon_start=1 /product="two Strep-Tag(R)II moieties connected by a linker for enhanced binding to Strep-Tactin(R), an engineered form of streptavidin (Schmidt et al., 2013)" /label=Twin-Strep-tag /translation="SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK" polyA_signal 869..980 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" ORIGIN 1 agctgcaata aacaagttaa caacaacaat tgcattcatt ttatgtttca ggttcagggg 61 gaggtgtggg aggtttttta atgcatccac ggggttgggg ttgcgccttt tccaaggcag 121 ccctgggttt gcgcagggac gcggctgctc tgggcgtggt tccgggaaac gcagcggcgc 181 cgaccctggg tctcgcacat tcttcacgtc cgttcgcagc gtcacccgga tcttcgccgc 241 tacccttgtg ggccccccgg cgacgcttcc tgctccgccc ctaagtcggg aaggttcctt 301 gcggttcgcg gcgtgccgga cgtgacaaac ggaagccgca cgtctcacta gtaccctcgc 361 agacggacag cgccagggag caatggcagc gcgccgaccg cgatgggctg tggccaatag 421 cggctgctca gcagggcgcg ccgagagcag cggccgggaa ggggcggtgc gggaggcggg 481 gtgtggggcg gtagtgtggg ccctgttcct gcccgcgcgg tgttccgcat tctgcaagcc 541 tccggagcgc acgtcggcag tcggctccct cgttgaccga atcaccgacc tctctcccca 601 ggggtaccct cagccttaag gcggccgccg agaatctgta ttttcaggga gccatgggat 661 ccgccggcga ctacaaggac cacgacggcg attataagga tcacgacatc gactacaaag 721 acgacgatga caagggcgcc agcagcgcct ggtcccaccc tcagtttgag aagggcggag 781 gctctggcgg cggaagcgga ggatctgctt ggagccaccc ccagttcgaa aagtgataac 841 tcgagtctag acgtttaaac cctgcaggct gtgccttcta gttgccagcc atctgttgtt 901 tgcccctccc ccgtgccttc cttgaccctg gaaggtgcca ctcccactgt cctttcctaa 961 taaaatgagg aaattgcatc gcattgtctg agtaggtgtc attctattct ggggggtggg 1021 gtgggg //