LOCUS Exported 896 bp ds-DNA linear SYN 06-JUL-2021 DEFINITION Express human Plekhm1 in mammalian cells. ACCESSION . VERSION . KEYWORDS hPlekhm1_pIRES puro Glue SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 896) AUTHORS Witwicka H, Jia H, Kutikov A, Reyes-Gutierrez P, Li X, Odgren PR TITLE TRAFD1 (FLN29) Interacts with Plekhm1 and Regulates Osteoclast Acidification and Resorption. JOURNAL PLoS One. 2015 May 19;10(5):e0127537. doi: 10.1371/journal.pone.0127537. eCollection 2015. PUBMED 25992615 REFERENCE 2 (bases 1 to 896) AUTHORS . TITLE Direct Submission JOURNAL Exported Jul 6, 2021 from SnapGene Server 1.1.58 http://www.snapgene.com FEATURES Location/Qualifiers source 1..896 /organism="synthetic DNA construct" /mol_type="other DNA" primer_bind 40..59 /label=T7 /note="T7 promoter, forward primer" promoter 40..58 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" regulatory 100..109 /regulatory_class="other" /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" CDS 106..219 /codon_start=1 /product="streptavidin-binding peptide" /label=SBP /note="selected from a peptide library; binds streptavidin with nanomolar affinity (Keefe et al., 2001)" /translation="MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP" CDS 238..258 /codon_start=1 /product="tobacco etch virus (TEV) protease recognition and cleavage site" /label=TEV site /translation="ENLYFQG" CDS 265..291 /codon_start=1 /product="HA (human influenza hemagglutinin) epitope tag" /label=HA /translation="YPYDVPDYA" CDS 292..369 /codon_start=1 /product="calmodulin-binding peptide" /label=CBP /note="derived from skeletal muscle myosin light chain kinase; binds calmodulin with nanomolar affinity in the presence of calcium" /translation="KRRWKKNFIAVSAANRFKKISSSGAL" ORIGIN 1 gctaactaga gaacccactg cttactggct tatcgaaatt aatacgactc actataggga 61 gacccaagct tggtaccgag ctcggatcga tttaattaag ccaccatgga cgagaagacc 121 accggctggc ggggcggcca cgtggtggag ggcctggccg gcgagctgga gcagctgcgg 181 gcccggctgg agcaccaccc ccagggccag cgggagcccg gcggaagccc cggtggcgag 241 aacctgtact tccagggcgc aagctacccc tacgacgtgc ccgactacgc caagcggcgg 301 tggaagaaga acttcatcgc cgtgagcgcc gccaaccggt tcaagaagat cagcagcagc 361 ggcgccctga ttgatggggg atctggcccc ggcggcggcg cgcctgtaca gatatcaatg 421 ctttcagtgg tggagaatgg actggacccc caggctgcca tcccggtcat caagaagaag 481 ctggtgggat ccgtgaaggc cttgcagaag cagtacgtgt ccctggacac ggtggtcact 541 agtgaagacg gagatgccaa caccatgtgc agcgccctgg aggccgtatt tatccatggc 601 ctgcacgcca agcacatccg agctgaggcc ggaggaaaaa ggaagaaaag tgcccaccag 661 aagcctctgc cccagcctgt cttctggccc ctcctgaaag ctgtcaccca caaacacatc 721 atctcagagt tggagcacct gacgtttgtc aacacggatg tgggccgctg ccgggcatgg 781 ctgcggctgg ccctgaacga tggcctgatg gagtgctacc tgaagctgct gctgcaggag 841 caggcccgct tgcatgagta ctaccagccc accgccctgc tccgggatgc tgagga //