LOCUS Exported 1871 bp ds-DNA circular SYN 13-MAY-2021 DEFINITION part designed to occupy position 20 of EMMA. Functional category: p2A sequence. ACCESSION . VERSION . KEYWORDS YCe2064 HC_Kan_p2A_p20 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 1871) AUTHORS Martella A, Matjusaitis M, Auxillos J, Pollard SM, Cai Y TITLE EMMA: An Extensible Mammalian Modular Assembly Toolkit for the Rapid Design and Production of Diverse Expression Vectors. JOURNAL ACS Synth Biol. 2017 Apr 24. doi: 10.1021/acssynbio.7b00016. PUBMED 28418644 REFERENCE 2 (bases 1 to 1871) AUTHORS . TITLE Direct Submission JOURNAL Exported May 13, 2021 from SnapGene Server 1.1.58 http://www.snapgene.com FEATURES Location/Qualifiers source 1..1871 /organism="synthetic DNA construct" /mol_type="other DNA" CDS 82..138 /codon_start=1 /product="2A peptide from porcine teschovirus-1 polyprotein" /label=P2A /note="Eukaryotic ribosomes fail to insert a peptide bond between the Gly and Pro residues, yielding separate polypeptides." /translation="ATNFSLLKQAGDVEENPGP" terminator 218..249 /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" promoter 250..352 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 353..1168 /codon_start=1 /gene="aph(3')-Ia" /product="aminoglycoside phosphotransferase" /label=KanR /note="confers resistance to kanamycin in bacteria or G418 (Geneticin(R)) in eukaryotes" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNGDRVFRLAQAQSRMNNGLVGA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" primer_bind complement(426..445) /label=Kan-R /note="Kanamycin resistance gene, reverse primer" terminator 1189..1216 /label=T7Te terminator /note="phage T7 early transcription terminator" rep_origin complement(1228..1815) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind complement(1308..1327) /label=pBR322ori-F /note="pBR322 origin, forward primer" terminator 1837..1866 /label=T3Te terminator /note="phage T3 early transcription terminator" ORIGIN 1 gttgattgca gtccagttac gctggagtct gaggctcgtc ctgaatgata tcaagcttga 61 attcgttacg tctcgagcgg cgctactaac ttcagcctgc tgaagcaggc tggcgacgtg 121 gaggagaacc ctggaccttc tggacgagac gaagacgaat tctctagata tcgctcaata 181 ctgaccattt aaatcatacc tgacctccat agcagaaagt caaaagcctc cgaccggagg 241 cttttgactt gatcggcacg taagaggttc caactttcac cataatgaaa taagatcact 301 accgggcgta ttttttgagt tatcgagatt ttcaggagct aaggaagcta aaatgagcca 361 tattcaacgg gaaacgtctt gctcgaggcc gcgattaaat tccaacatgg atgctgattt 421 atatgggtat aaatgggctc gcgataatgt cgggcaatca ggtgcgacaa tctatcgatt 481 gtatgggaag cccgatgcgc cagagttgtt tctgaaacat ggcaaaggta gcgttgccaa 541 tgatgttaca gatgagatgg tcaggctaaa ctggctgacg gaatttatgc ctcttccgac 601 catcaagcat tttatccgta ctcctgatga tgcatggtta ctcaccactg cgatcccagg 661 gaaaacagca ttccaggtat tagaagaata tcctgattca ggtgaaaata ttgttgatgc 721 gctggcagtg ttcctgcgcc ggttgcattc gattcctgtt tgtaattgtc cttttaacgg 781 cgatcgcgta tttcgtctcg ctcaggcgca atcacgaatg aataacggtt tggttggtgc 841 gagtgatttt gatgacgagc gtaatggctg gcctgttgaa caagtctgga aagaaatgca 901 taagcttttg ccattctcac cggattcagt cgtcactcat ggtgatttct cacttgataa 961 ccttattttt gacgagggga aattaatagg ttgtattgat gttggacgag tcggaatcgc 1021 agaccgatac caggatcttg ccatcctatg gaactgcctc ggtgagtttt ctccttcatt 1081 acagaaacgg ctttttcaaa aatatggtat tgataatcct gatatgaata aattgcagtt 1141 tcacttgatg ctcgatgagt ttttctgagg gcccaaatgt aatcacctgg ctcaccttcg 1201 ggtgggcctt tctgcgttgc tggcgttttt ccataggctc cgcccccctg acgagcatca 1261 caaaaatcga tgctcaagtc agaggtggcg aaacccgaca ggactataaa gataccaggc 1321 gtttccccct ggaagctccc tcgtgcgctc tcctgttccg accctgccgc ttaccggata 1381 cctgtccgcc tttctccctt cgggaagcgt ggcgctttct catagctcac gctgtaggta 1441 tctcagttcg gtgtaggtcg ttcgctccaa gctgggctgt gtgcacgaac cccccgttca 1501 gcccgaccgc tgcgccttat ccggtaacta tcgtcttgag tccaacccgg taagacacga 1561 cttatcgcca ctggcagcag ccactggtaa caggattagc agagcgaggt atgtaggcgg 1621 tgctacagag ttcttgaagt ggtggcctaa ctacggctac actagaagaa cagtatttgg 1681 tatctgcgct ctgctgaagc cagttacctc ggaaaaagag ttggtagctc ttgatccggc 1741 aaacaaacca ccgctggtag cggtggtttt tttgtttgca agcagcagat tacgcgcaga 1801 aaaaaaggat ctcaagaaga tcctttgatt ttctaccgaa gaaaggccca cccgtgaagg 1861 tgagccagtg a //