LOCUS Exported 375 bp ds-DNA linear SYN 20-MAY-2021 DEFINITION Expresses FAST (also called YFAST) in mammalian cells. ACCESSION . VERSION . KEYWORDS pAG104 FAST SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 375) AUTHORS Plamont MA, Billon-Denis E, Maurin S, Gauron C, Pimenta FM, Specht CG, Shi J, Querard J, Pan B, Rossignol J, Moncoq K, Morellet N, Volovitch M, Lescop E, Chen Y, Triller A, Vriz S, Le Saux T, Jullien L, Gautier A TITLE Small fluorescence-activating and absorption-shifting tag for tunable protein imaging in vivo. JOURNAL Proc Natl Acad Sci U S A. 2016 Jan 19;113(3):497-502. doi: 10.1073/pnas.1513094113. Epub 2015 Dec 28. PUBMED 26711992 REFERENCE 2 (bases 1 to 375) AUTHORS . TITLE Direct Submission JOURNAL Exported May 20, 2021 from SnapGene Server 1.1.58 http://www.snapgene.com FEATURES Location/Qualifiers source 1..375 /organism="synthetic DNA construct" /mol_type="other DNA" CDS 1..375 /codon_start=1 /product="small protein tag, derived from photoactive yellow protein, that allows in vivo fluorescent labeling by addition of a cell-permeant fluorogen (Plamont et al., 2016)" /label=Y-FAST /translation="MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAA EGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFKEGVASGNLNTMFEWMIPTSRGPTK VKVHMKKALSGDSYWVFVKRV" ORIGIN 1 atggagcatg ttgcctttgg cagtgaggac atcgagaaca ctctggccaa aatggacgac 61 ggacaactgg atgggttggc ctttggcgca attcagctcg atggtgacgg gaatatcctg 121 cagtacaatg ctgctgaagg agacatcaca ggcagagatc ccaaacaggt gattgggaag 181 aacttcttca aggatgttgc acctggaacg gattctcccg agttttacgg caaattcaag 241 gaaggcgtag cgtcagggaa tctgaacacc atgttcgaat ggatgatacc gacaagcagg 301 ggaccaacca aggtcaaggt gcacatgaag aaagcccttt ccggtgacag ctattgggtc 361 tttgtgaaac gggtg //