LOCUS Exported 900 bp ds-DNA linear SYN 23-MAY-2021 DEFINITION synthetic linear DNA ACCESSION . VERSION . KEYWORDS pDN-D2irTNG4kwh SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 900) AUTHORS Nevozhay D, Zal T, Balazsi G TITLE Transferring a synthetic gene circuit from yeast to mammalian cells. JOURNAL Nat Commun. 2013 Feb 5;4:1451. doi: 10.1038/ncomms2471. PUBMED 23385595 REFERENCE 2 (bases 1 to 900) AUTHORS . TITLE Direct Submission JOURNAL Exported May 23, 2021 from SnapGene Server 1.1.58 http://www.snapgene.com FEATURES Location/Qualifiers source 1..900 /organism="synthetic DNA construct" /mol_type="other DNA" promoter 93..140 /label=EM7 promoter /note="synthetic bacterial promoter " CDS 159..533 /codon_start=1 /gene="Sh ble from Streptoalloteichus hindustanus" /product="antibiotic-binding protein" /label=BleoR /note="confers resistance to bleomycin, phleomycin, and Zeocin(TM)" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" polyA_signal 663..784 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" primer_bind complement(700..719) /label=SV40pA-R /note="SV40 polyA, reverse primer" primer_bind 754..773 /label=EBV-rev /note="SV40 polyA terminator, reverse primer" primer_bind complement(833..849) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" primer_bind complement(833..849) /label=M13 Reverse /note="In lacZ gene. Also called M13-rev" primer_bind complement(846..868) /label=M13/pUC Reverse /note="In lacZ gene" protein_bind 857..873 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." ORIGIN 1 cagaagtagt gaggaggctt ttttggaggc ctaggctttt gcaaaaagct cccgggagct 61 tgtatatcca ttttcggatc tgatcagcac gtgttgacaa ttaatcatcg gcatagtata 121 tcggcatagt ataatacgac aaggtgagga actaaaccat ggccaagttg accagtgccg 181 ttccggtgct caccgcgcgc gacgtcgccg gagcggtcga gttctggacc gaccggctcg 241 ggttctcccg ggacttcgtg gaggacgact tcgccggtgt ggtccgggac gacgtgaccc 301 tgttcatcag cgcggtccag gaccaggtgg tgccggacaa caccctggcc tgggtgtggg 361 tgcgcggcct ggacgagctg tacgccgagt ggtcggaggt cgtgtccacg aacttccggg 421 acgcctccgg gccggccatg accgagatcg gcgagcagcc gtgggggcgg gagttcgccc 481 tgcgcgaccc ggccggcaac tgcgtgcact tcgtggccga ggagcaggac tgacacgtgc 541 tacgagattt cgattccacc gccgccttct atgaaaggtt gggcttcgga atcgttttcc 601 gggacgccgg ctggatgatc ctccagcgcg gggatctcat gctggagttc ttcgcccacc 661 ccaacttgtt tattgcagct tataatggtt acaaataaag caatagcatc acaaatttca 721 caaataaagc atttttttca ctgcattcta gttgtggttt gtccaaactc atcaatgtat 781 cttatcatgt ctgtataccg tcgacctcta gctagagctt ggcgtaatca tggtcatagc 841 tgtttcctgt gtgaaattgt tatccgctca caattccaca caacatacga gccggaagca //