LOCUS Exported 652 bp ds-DNA linear SYN 25-MAY-2021 DEFINITION Destination vector for Voytas Golden Gate TALEN assembly incorporating a CAG promoter for mammalian expression and a T7 promoter for synthesis of TALEN mRNA. Uses homodimeric FokI domains.. ACCESSION . VERSION . KEYWORDS pCAG-T7-TALEN(Sangamo)-Destination SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 652) AUTHORS Hermann M, Cermak T, Voytas DF, Pelczar P TITLE Mouse genome engineering using designer nucleases. JOURNAL J Vis Exp. 2014 Apr 2;(86). doi: 10.3791/50930. PUBMED 24747757 REFERENCE 2 (bases 1 to 652) AUTHORS . TITLE Direct Submission JOURNAL Exported May 25, 2021 from SnapGene Server 1.1.58 http://www.snapgene.com FEATURES Location/Qualifiers source 1..652 /organism="synthetic DNA construct" /mol_type="other DNA" CDS complement(30..437) /codon_start=1 /gene="lacZ fragment" /product="LacZ-alpha fragment of beta-galactosidase" /label=lacZ-alpha /translation="MTMITPSAQLTLTKGNKSWRTSRGGPVPNSPYSESYYARSLAVVL QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWDAPCSGARLQGG TRQCIARCMHCLHCGHAATFCNLHKLACVQL" primer_bind 287..309 /label=M13/pUC Forward /note="In lacZ gene" primer_bind 301..318 /label=M13 Forward /note="In lacZ gene. Also called M13-F20 or M13 (-21) Forward" primer_bind 302..318 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" primer_bind 328..347 /label=T7 /note="T7 promoter, forward primer" promoter 328..346 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(394..414) /label=T3 /note="T3 promoter, forward primer" promoter complement(394..412) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(433..449) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" primer_bind complement(433..449) /label=M13 Reverse /note="In lacZ gene. Also called M13-rev" primer_bind complement(446..468) /label=M13/pUC Reverse /note="In lacZ gene" protein_bind 457..473 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(481..511) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 526..547 /label=CAP binding site /bound_moiety="E. coli catabolite activator protein" /note="CAP binding activates transcription in the presence of cAMP." ORIGIN 1 cggatgcggg ggagttgaga ggtccgccgt tacagttgga cacaggccaa cttgtgaaga 61 ttgcaaaacg tggcggcgtg accgcaatgg aggcagtgca tgcatcgcgc aatgcactga 121 cgggtgcccc cctggagacg ggcgccgcta cagggcgcgt cccattcgcc attcaggctg 181 cgcaactgtt gggaagggcg atcggtgcgg gcctcttcgc tattacgcca gctggcgaaa 241 gggggatgtg ctgcaaggcg attaagttgg gtaacgccag ggttttccca gtcacgacgt 301 tgtaaaacga cggccagtga gcgcgcgtaa tacgactcac tatagggcga attgggtacc 361 gggccccccc tcgaggtcct ccagcttttg ttccctttag tgagggttaa ttgcgcgctt 421 ggcgtaatca tggtcatagc tgtttcctgt gtgaaattgt tatccgctca caattccaca 481 caacatacga gccggaagca taaagtgtaa agcctggggt gcctaatgag tgagctaact 541 cacattaatt gcgttgcgct cactgcccgc tttccaccgg tcgtctccaa cgaccacctc 601 gtcgccttgg cctgcctcgg cggacgtcct gccatggatg cagtgaaaaa gg //