LOCUS Exported 249 bp ds-DNA linear SYN 18-MAY-2021 DEFINITION use to create N-terminal Twin-Strep-tag fusion proteins or dual tagged fusion with N-terminal Twin-Strep-tag and C-terminal 6x His-tag. ACCESSION . VERSION . KEYWORDS pTD-NTwinStrep_Sm SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 249) AUTHORS Dammeyer T, Timmis KN, Tinnefeld P TITLE Broad host range vectors for expression of proteins with (Twin-) Strep-tag, His-tag and engineered, export optimized yellow fluorescent protein. JOURNAL Microb Cell Fact. 2013 May 20;12(1):49. PUBMED 23687945 REFERENCE 2 (bases 1 to 249) AUTHORS . TITLE Direct Submission JOURNAL Exported May 18, 2021 from SnapGene Server 1.1.58 http://www.snapgene.com FEATURES Location/Qualifiers source 1..249 /organism="synthetic DNA construct" /mol_type="other DNA" CDS 34..123 /codon_start=1 /product="two Strep-Tag(R)II moieties connected by a linker for enhanced binding to Strep-Tactin(R), an engineered form of streptavidin (Schmidt et al., 2013)" /label=Twin-Strep-tag /translation="SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK" CDS 220..237 /codon_start=1 /product="6xHis affinity tag" /label=6xHis /translation="HHHHHH" ORIGIN 1 cgtagccaat tggaaggaga tatacaaatg gctagcgctt ggagccaccc gcagttcgag 61 aaaggtggag gttccggagg tggatcggga ggttcggcgt ggagccaccc gcagttcgaa 121 aaaggcgccg agaccgcggt cccgaattcg agctcggtac ccggggatcc ctcgaggtcg 181 acctgcaggg ggaccatggt ctcaggcctg agaggatcgc atcaccatca ccatcactaa 241 aagcttgtc //