LOCUS Exported 998 bp ds-DNA linear SYN 17-MAY-2021 DEFINITION synthetic linear DNA ACCESSION . VERSION . KEYWORDS pICH47751 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 998) AUTHORS Weber E, Engler C, Gruetzner R, Werner S, Marillonnet S TITLE A modular cloning system for standardized assembly of multigene constructs. JOURNAL PLoS One. 2011 Feb 18;6(2):e16765. doi: 10.1371/journal.pone.0016765. PUBMED 21364738 REFERENCE 2 (bases 1 to 998) AUTHORS . TITLE Direct Submission JOURNAL Exported May 17, 2021 from SnapGene Server 1.1.58 http://www.snapgene.com FEATURES Location/Qualifiers source 1..998 /organism="synthetic DNA construct" /mol_type="other DNA" misc_feature 27..51 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" CDS complement(193..516) /codon_start=1 /gene="lacZ fragment" /product="LacZ-alpha fragment of beta-galactosidase" /label=lacZ-alpha /translation="MTMITPSLHACRSTLEDPRVPSSNSLAVVLQRRDWENPGVTQLNR LAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGISHRIWCTLSTICS DAA" primer_bind 198..217 /label=pRS-marker /note="pRS vectors, use to sequence yeast selectable marker" primer_bind 411..433 /label=M13/pUC Forward /note="In lacZ gene" primer_bind 425..442 /label=M13 Forward /note="In lacZ gene. Also called M13-F20 or M13 (-21) Forward" primer_bind 426..442 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 443..499 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(512..528) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" primer_bind complement(512..528) /label=M13 Reverse /note="In lacZ gene. Also called M13-rev" primer_bind complement(525..547) /label=M13/pUC Reverse /note="In lacZ gene" protein_bind 536..552 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(560..590) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 605..626 /label=CAP binding site /bound_moiety="E. coli catabolite activator protein" /note="CAP binding activates transcription in the presence of cAMP." misc_feature 797..821 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" ORIGIN 1 ttctaataaa cgctcttttc tcttaggttt acccgccaat atatcctgtc aaacactgat 61 agtttaaacc acttcgtgca gaagacaagt aaagcgtgag accgtcacag cttgtctgta 121 agcggatgcc gggagcagac aagcccgtca gggcgcgtca gcgggtgttg gcgggtgtcg 181 gggctggctt aactatgcgg catcagagca gattgtactg agagtgcacc atatgcggtg 241 tgaaataccg cacagatgcg taaggagaaa ataccgcatc aggcgccatt cgccattcag 301 gctgcgcaac tgttgggaag ggcgatcggt gcgggcctct tcgctattac gccagctggc 361 gaaaggggga tgtgctgcaa ggcgattaag ttgggtaacg ccagggtttt cccagtcacg 421 acgttgtaaa acgacggcca gtgaattcga gctcggtacc cggggatcct ctagagtcga 481 cctgcaggca tgcaagcttg gcgtaatcat ggtcatagct gtttcctgtg tgaaattgtt 541 atccgctcac aattccacac aacatacgag ccggaagcat aaagtgtaaa gcctggggtg 601 cctaatgagt gagctaactc acattaattg cgttgcgctc actgcccgct ttccagtcgg 661 gaaacctgtc gtgccagctg cggtctcact ccgagctcga attctagttt gtcttcacag 721 agtggggccc actgcatcca ccccagtaca ttaaaaacgt ccgcaatgtg ttattaagtt 781 gtctaagcgt caatttgttt acaccacaat atatcctgcc accagccagc caacagctcc 841 ccgaccggca gctcggcaca aaatcaccac tcgatacagg cagcccatca gtcagatcag 901 gatctccttt gcgacgctca ccgggctggt tgccctcgcc gctgggctgg cggccgtcta 961 tggccctgca aacgcgccag aaacgccgtc gaagccgt //