LOCUS Exported 646 bp ds-DNA linear SYN 02-JUN-2021 DEFINITION MESA target chain with mCherry ectodomain, no linker domain, G cleavage sequence, and tTA-BFP fusion . ACCESSION . VERSION . KEYWORDS mCherry_LD 0_CS G_tTA-BFP SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 646) AUTHORS Daringer NM, Dudek RM, Schwarz KA, Leonard JN TITLE Modular Extracellular Sensor Architecture for Engineering Mammalian Cell-based Devices. JOURNAL ACS Synth Biol. 2014 Mar 11. PUBMED 24611683 REFERENCE 2 (bases 1 to 646) AUTHORS . TITLE Direct Submission JOURNAL Exported Jun 2, 2021 from SnapGene Server 1.1.58 http://www.snapgene.com FEATURES Location/Qualifiers source 1..646 /organism="synthetic DNA construct" /mol_type="other DNA" CDS 166..396 /codon_start=1 /gene="UL48" /product="transcriptional activation domain of herpes simplex virus protein VP16 (Triezenberg et al., 1988; Cousens et al., 1989)" /label=VP16 AD /translation="APPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGF TPHDSAPYGALDMADFEFEQMFTDALGIDEYG" primer_bind complement(475..496) /label=EGFP-N /note="EGFP, reverse primer" ORIGIN 1 tgtgaaagtg ggtccgcgta cagccgcgcg cgtacgaaaa acaattacgg gtctaccatc 61 gagggcctgc tcgatctccc ggacgacgac gcccccgaag aggcggggct ggcggctccg 121 cgcctgtcct ttctccccgc gggacacacg cgcagactgt cgacggcccc cccgaccgat 181 gtcagcctgg gggacgagct ccacttagac ggcgaggacg tggcgatggc gcatgccgac 241 gcgctagacg atttcgatct ggacatgttg ggggacgggg attccccggg tccgggattt 301 accccccacg actccgcccc ctacggcgct ctggatatgg ccgacttcga gtttgagcag 361 atgtttaccg atgcccttgg aattgacgag tacggtggag gtaccggcgg aggctccggt 421 ggtggctcta tggtgagcaa gggcgaggag ctgttcaccg gggtggtgcc catcctggtc 481 gagctggacg gcgacgtaaa cggccacaag ttcagcgtga ggggcgaggg cgagggcgat 541 gccaccaacg gcaagctgac cctgaagttc atctgcacca ccggcaagct gcccgtgccc 601 tggcccaccc tcgtgaccac cctgagccac ggcgtgcagt gcttcg //